Protein Info for GFF1282 in Xanthobacter sp. DMC5

Annotation: Phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 21 to 54 (34 residues), see Phobius details TIGR00164: phosphatidylserine decarboxylase homolog" amino acids 14 to 219 (206 residues), 199.9 bits, see alignment E=1.5e-63 PF02666: PS_Dcarbxylase" amino acids 47 to 217 (171 residues), 146.4 bits, see alignment E=4.5e-47

Best Hits

Swiss-Prot: 90% identical to PSD_XANP2: Phosphatidylserine decarboxylase proenzyme (psd) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 90% identity to xau:Xaut_4662)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>GFF1282 Phosphatidylserine decarboxylase proenzyme (Xanthobacter sp. DMC5)
LSIIASIRKTLVPIHREGYPFIAIAVVIALVLFVFSTFFGMIGFGLAIWTALFFRDPERV
TPVREGLVIAPADGRVSQVGLARPPRELDLSDEPLLRVSIFMNVFNVHVNRAPVTGRIER
IAYKPGLFLNADLDKASEDNERNGLIISTPYCRVGCVQIAGLVARRIVSFVREGESIGSG
ERFGLIRFGSRVDVYLPVGSRVLVSEGQLTVAGETVLCDLSQPQQRETAYRVS