Protein Info for GFF1281 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 216 to 232 (17 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 30 to 181 (152 residues), 84.6 bits, see alignment E=9.8e-28 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 36 to 201 (166 residues), 109.3 bits, see alignment E=9.7e-36 PF08009: CDP-OH_P_tran_2" amino acids 217 to 252 (36 residues), 50.1 bits, see alignment 2.1e-17

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 91% identity to xau:Xaut_4661)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF1281 hypothetical protein (Xanthobacter sp. DMC5)
METPFPPFDPEGRPRPRLGGSIGKVPIRVLLPNLVTLLALCSGLTAVRLAIEERIELALA
AIVFAAILDGVDGRLARALKGTSRFGAELDSLADFVNFGCVPALMLYFWGLKEAGSFGWI
AALAYAICAALRLARFNVMLDDPNKPPFAGDYFTGIPAPAGAITVLLPVYLELIGLPHGR
VSALIALVYCLAIAFLMISTVPAWSGKTLGRRVRRDMVLPLFVAVAIYFALLASYPWIVL
SVCTILYLALLPVSTVRYRRQMKAWKAERAAAATAGPDVLPS