Protein Info for GFF1279 in Xanthobacter sp. DMC5

Annotation: Dipeptide transport system permease protein DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 97 (97 residues), 47.9 bits, see alignment E=1.4e-16 PF00528: BPD_transp_1" amino acids 113 to 334 (222 residues), 129.6 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 43% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 94% identity to xau:Xaut_4659)

MetaCyc: 40% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF1279 Dipeptide transport system permease protein DppB (Xanthobacter sp. DMC5)
MLKLLGSRLATAVPSLIGVVIVTFLLTRVLPGDTAAYFAGPAATPQAIAEIRTKLGLDKS
LPAQFADYVSALAHGDLGSSLSTGQPVATEIASRLPASAELTLAGLVLALLIAVPFGIMA
AVRQGSWIDHACRIITTAGVSLPVFFTGLLLVYVFYFKLGWAPAPLGRLDVFFSAPETVT
GFYLIDSLIARDFETFRAALAQLAVPAITLAIFALAPIARMTRASMLAVLSSEFVRTAKA
AGLTDYTVIITYAFRNAMLPVVTTLGMVFSFLLGANVLVEKVFAWPGIGSYAVEALITSD
YAPVQGFVLAMAILYVILNLLIDLAYGIIDPRARSEA