Protein Info for GFF1279 in Sphingobium sp. HT1-2

Annotation: Uncharacterized protein YhiN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF07992: Pyr_redox_2" amino acids 4 to 164 (161 residues), 32.9 bits, see alignment E=1.4e-11 PF03486: HI0933_like" amino acids 5 to 388 (384 residues), 284.5 bits, see alignment E=2.2e-88 PF00890: FAD_binding_2" amino acids 5 to 54 (50 residues), 27.7 bits, see alignment 4.7e-10 TIGR00275: flavoprotein, HI0933 family" amino acids 7 to 388 (382 residues), 375.7 bits, see alignment E=1.3e-116 PF13450: NAD_binding_8" amino acids 8 to 39 (32 residues), 22.2 bits, see alignment (E = 4.3e-08) PF22780: HI0933_like_1st" amino acids 188 to 335 (148 residues), 111.2 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 53% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 70% identity to sch:Sphch_1948)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF1279 Uncharacterized protein YhiN (Sphingobium sp. HT1-2)
MGDYDAIILGAGAAGMMCAATAGQRGRRVLLADHADAPGKKILISGGGRCNFTNIHTAAD
RYLSANPHFAKSALGRYTPQDFLTLIGRYGIAWHEKTLGQLFCDGSAKQVVGMLEEECAA
GGVTMALGQPVTDISHGDGLFRVKLGDRILSAPSLVLATGGPSIPKLGATGFAYEIARQF
DLKVVQPRPALVPFTLGPDDALFQSLSGVSAEVEVRWNKTRFREAALFTHRGLSGPAMLQ
ISSYWEHRTPIHVNFLPDLGVDWLLAEKRNRPRTGLRRVLVERFPERMADALLERIGTQG
DLGNLPDKTLRQIGERLAGWSFIPSGTEGYAKAEVTVGGIATAGLSSRTMEAAKVPGLYA
IGEAVDVTGWLGGYNFQWAWASGWAAGQAL