Protein Info for GFF1277 in Xanthobacter sp. DMC5

Annotation: Glutathione import ATP-binding protein GsiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF00005: ABC_tran" amino acids 43 to 201 (159 residues), 89.9 bits, see alignment E=3.5e-29 amino acids 349 to 503 (155 residues), 112.5 bits, see alignment E=3.6e-36 PF13304: AAA_21" amino acids 151 to 235 (85 residues), 28.9 bits, see alignment E=1.7e-10 PF08352: oligo_HPY" amino acids 252 to 295 (44 residues), 34.2 bits, see alignment 4.2e-12 amino acids 554 to 581 (28 residues), 17.1 bits, see alignment (E = 8.7e-07)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 88% identity to xau:Xaut_4657)

Predicted SEED Role

"Putative dipeptide ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>GFF1277 Glutathione import ATP-binding protein GsiA (Xanthobacter sp. DMC5)
MHGVVDVKEHAAKSSEAPSGPLLEVRDLTVEFATRRGIVTAVSKVDLTLGKGETLGIVGE
SGSGKSVTSYTVMRILDRAGRIAEGSITFSGIDVAHAPESEMRDLRGREMSMIFQNPRAA
LNPIRTVGAQIGDVLLQHVQADPRNVKHKVIDILKQVRIARPEDRYHAYPFELSGGMCQR
IVIALALACRPQLMIADEPTTGLDVTTQKAVMDLVTELTRERGMSTILITHDLGLAATYC
DTVMVMEKGKVVETAPAERIFRDPQHPYTRKLMRATPRPGITLKDLLPEGEGAPAAAAAR
SPVADAGAPLLTVENLVREYPRQGAPSAFLAKLKGKPLTPEETIFRAVDGISFEVKRGES
VGLVGESGCGKSTTSTMVMRLIDPTAGKITFAGEDIGAIPAKDFAHHPMRKRIQMVFQDP
TESLNPRYTAARAIADPLLRMGGYSGGAKLDARVAELADMVGLPQNLLERFPHQLSGGQK
ARIGIARAIALDPDLVILDEPTAALDVSVQAVVLNLLEELKQRLGMSYLFVSHDLHVVGL
LCDRVIVMRQGRIVEEGTAREVLEAPKDAYTRELIAAIPHPPV