Protein Info for GFF1268 in Variovorax sp. SCN45

Annotation: FIG022199: FAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 226 to 247 (22 residues), see Phobius details PF01494: FAD_binding_3" amino acids 18 to 338 (321 residues), 85.1 bits, see alignment E=2e-27 PF00890: FAD_binding_2" amino acids 19 to 54 (36 residues), 23.7 bits, see alignment 9.1e-09 PF12831: FAD_oxidored" amino acids 19 to 180 (162 residues), 36.5 bits, see alignment E=1.3e-12 PF04820: Trp_halogenase" amino acids 19 to 102 (84 residues), 47.7 bits, see alignment E=3.9e-16 amino acids 108 to 365 (258 residues), 59.3 bits, see alignment E=1.1e-19 PF05834: Lycopene_cycl" amino acids 19 to 177 (159 residues), 29 bits, see alignment E=2.1e-10 PF13450: NAD_binding_8" amino acids 22 to 55 (34 residues), 33.2 bits, see alignment 1.8e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_2686)

Predicted SEED Role

"FIG022199: FAD-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>GFF1268 FIG022199: FAD-binding protein (Variovorax sp. SCN45)
MSLPQASSPTPSAADESCDVMVVGGGPAGSTVAALLAQQGRKVVLLEKAQHPRFHIGESL
LPANVELFEKLGVREQVEKIGMPKFGIEFVSPEHEHRSYVDFAEGWDKSLDSAWQVRRSE
LDELLFRNAAERGAQAIEGCKVRDVAFDADGATVRAEMDDGAKRNWRARFVVDATGRDTL
LANKFRCKQKNPDHNSTAVFGHFTNAERLEGKKEGNISICWFPHGWFWFIPLADGTTSVG
AVCWPYYLKTREKPLKDFFYDTIALCPVLQDRLKNATLVDDAVHATGNFSYSSTHATGDR
YLMLGDAFTFIDPMFSSGVYLAMHSAFDGAKLVATALDQPAELAAARQGFEAMMRKGPRE
YSWFIYRVTNPTIRDMFMYPGNPFRVKEALMSLLAGDIYNGTPMWNALRMFKVLYYGISI
ANFRRTWAGWKRHRFNTRDMGMLKGETILKSD