Protein Info for GFF1265 in Xanthobacter sp. DMC5

Annotation: Protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 36 to 313 (278 residues), 327 bits, see alignment E=6.7e-102 PF01040: UbiA" amino acids 51 to 298 (248 residues), 214.2 bits, see alignment E=9.8e-68

Best Hits

Swiss-Prot: 80% identical to COXX_AZOC5: Protoheme IX farnesyltransferase (ctaB) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 89% identity to xau:Xaut_4646)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1, 2.5.1.-

Use Curated BLAST to search for 1.9.3.1 or 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF1265 Protoheme IX farnesyltransferase (Xanthobacter sp. DMC5)
MSDERASLTGPDPYAMASGGVASAGVAAGEGHAAPRDYFELLKPRVMSLVIFTALVGLVR
APGDVHPVIAFTALLCIAVGAGASGALNMWWDADIDAVMARTRGRPVPSGRVTGQEALAF
GLTLSAFSVVVLGLLVNALSGALLAFTIFFYVVIYTMWLKRSTSQNIVIGGAAGAFPPLV
AWAAASGTVSLEPVLLFAIIFFWTPPHFWALALYRADDYARAGVPMLPVTAGPDETRLQI
LLYTLFLVPLAASPAFLGYAGLAYGAVSVLAGAWMIVLAVRVFRVREGEAAVKAAKGLFG
FSIVYLFALFATLLGEAVISGLLR