Protein Info for GFF1264 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 332 (329 residues), 88.3 bits, see alignment E=2.6e-29

Best Hits

KEGG orthology group: None (inferred from 77% identity to sch:Sphch_0979)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>GFF1264 hypothetical protein (Sphingobium sp. HT1-2)
MRISSLTGLRGIAAVSVLLYHIPHAPAFQAFAIPLFSRAYLAVDLFFILSGFVISYGYYD
RLMHNLGRSSYMDFLINRTARVWPLHLIVTLVFMARILVNVSGTQAIPLDLPNILTNLLM
IQSWGWGTQPIAGNSWSVSTEVAAYLLYPLIAIMAFSRWAWAQLALCVGILVLVASSGRG
ASGPLDVNDYDTVLTLLRCLAGFALGVLTYRIRDMALTRSLLDGPGRFAAICVIIAVALM
LPRAADVLVVCLMPALVLTCYYDGAAARAVMANPVSYHLGLISYSIYLWHPLVRDIMARV
MGIAHRHGFVGHDWIFIAAMLVATWLLCWASYRLIELPGHKIIKWLQRGGRARPAPVKVA
A