Protein Info for GFF1262 in Xanthobacter sp. DMC5

Annotation: Cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 204 to 229 (26 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details PF00510: COX3" amino acids 9 to 270 (262 residues), 317.2 bits, see alignment E=5.9e-99

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 88% identity to xau:Xaut_4643)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF1262 Cytochrome c oxidase subunit 3 (Xanthobacter sp. DMC5)
MADVHIKKHDYHVVDPSPWPIIGSVAALILTSGAVVWMHGGTALIMTVGFLGVLYTMFGW
WRDVIRESRAGFHTRVVVLGLRYGVILFIASEVMFFVAWFWAFFDASLFAGEAINFQRME
FTGGMWPPKGIESLDPWHLPLLNTLILLTSGTTVTWAHHALVHGDRQGLKWGLWCTVVLG
VLFSMCQAYEYYHAHFHFAGNIYGATFFMATGFHGFHVIVGTIFLAVCLMRTYMGDFTPQ
KHFGFEAAAWYWHFVDVVWLFLFTFIYVWAQGGHA