Protein Info for GFF1260 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details PF02104: SURF1" amino acids 23 to 235 (213 residues), 184.3 bits, see alignment E=1.9e-58

Best Hits

KEGG orthology group: K14998, surfeit locus 1 family protein (inferred from 75% identity to xau:Xaut_4641)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF1260 hypothetical protein (Xanthobacter sp. DMC5)
VTGNTPSAAPRGRGLVLFVLACAAFAVLIGLGTWQLNRLAWKEALLARVEARVHAAPEDV
PPPARWPSLTREEDEYRRVKVRGTFDHAKEALVYTVRGEDAAGPVKGQGFLVVTPLIRAD
GPPILVNRGFVPSDRRDPATRAEGEIKGEVEVVGLLRFPEEASWFVPANDPAHGSFYRME
PAEIAAARGISGAAPFLIDADATPVPGGLPIGGGTRIAFPNRHLEYALTWYGLAASLVGV
GIAVFISRRRRAA