Protein Info for PS417_06365 in Pseudomonas simiae WCS417

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02394: RNA polymerase sigma factor RpoS" amino acids 56 to 333 (278 residues), 460.8 bits, see alignment E=1.9e-142 PF00140: Sigma70_r1_2" amino acids 61 to 94 (34 residues), 47.9 bits, see alignment 2.1e-16 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 96 to 322 (227 residues), 117.5 bits, see alignment E=4.7e-38 PF04542: Sigma70_r2" amino acids 99 to 168 (70 residues), 82.3 bits, see alignment E=3.6e-27 PF04539: Sigma70_r3" amino acids 179 to 253 (75 residues), 75.4 bits, see alignment E=6.3e-25 PF04545: Sigma70_r4" amino acids 267 to 320 (54 residues), 51.1 bits, see alignment 1.5e-17

Best Hits

Swiss-Prot: 89% identical to RPOS_PSEAE: RNA polymerase sigma factor RpoS (rpoS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 99% identity to pfs:PFLU1302)

MetaCyc: 76% identical to RNA polymerase sigma factor RpoS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoS" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UE15 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PS417_06365 RNA polymerase sigma factor (Pseudomonas simiae WCS417)
MALSKEAPEFDIDDEVLLMEAGIDTESMSNEGPAVPSVRTKSKNSTALKQHKYIDYTRAL
DATQLYLNEIGFSPLLTPEEEVHFARLSQKGDPAGRKRMIESNLRLVVKIARRYVNRGLS
LLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHVVKEL
NVYLRAARELTQKLDHEPSPEEIANLLEKPVGEVKRMLGLNERVSSVDVSLGPDSDKTLL
DTLTDDRPTDPCELLQDDDLSQSIDQWLSELTDKQREVVIRRFGLRGHESSTLEDVGLEI
GLTRERVRQIQVEGLKRLREILEKNGLSSESLFQ