Protein Info for GFF1252 in Xanthobacter sp. DMC5

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 899 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details PF13188: PAS_8" amino acids 95 to 123 (29 residues), 14.7 bits, see alignment (E = 7e-06) amino acids 414 to 452 (39 residues), 19 bits, see alignment (E = 3e-07) PF08448: PAS_4" amino acids 414 to 512 (99 residues), 27.5 bits, see alignment E=9.3e-10 PF00512: HisKA" amino acids 529 to 590 (62 residues), 33 bits, see alignment 1.6e-11 PF02518: HATPase_c" amino acids 634 to 753 (120 residues), 81.6 bits, see alignment E=1.7e-26 PF00072: Response_reg" amino acids 783 to 893 (111 residues), 86.1 bits, see alignment E=5.7e-28

Best Hits

Predicted SEED Role

"multi-sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (899 amino acids)

>GFF1252 Sensor histidine kinase RcsC (Xanthobacter sp. DMC5)
MVQERMRGRQKKDQGTAVRRKKSRRAGPLGTRLFIVAFALAGGFVGATILGRDGGGIPSA
IIAALAVVGVVELFLAARRTFKGAEPEDPLGAIALAASGDAMAVVEDGERIVEANAAYLR
MCRSGTAEPPLPERFLSRIPGSQTTVGELLNAVAGSTAHLSTMPFGSGVRGRQLEVSVHP
VGGPRRVLWTLRMVDTGEGEAPTFAPVPAPAAHPVAPVVAKPLPAAPAVRPPDPVVVAPA
PAVAAPVPVAAPLPASEANAPALSTAAPAPAPEGYAGPDLVASWEELPAGLLRIVGGRVV
DPNLTFCRMLGYALAEWGPDGMALSRIVAPESMPSLAAAQANGGRASLVASLRRKDGAAL
PVLLRIAAAPDGTGAVALPLDAVEGALGAASPRTTDTQAPRGDGTEVLGDLFFRRAPLAM
ALVDRSGGVRAANAAFERLFGRDAAGRPLTALVSDPSGTEALLAAAAGASEPPAPCDVTL
AGGSARSVRFYAAPLDPSGDIALCAIDMTEQRALEVQFAQSQKLQAVGHLAGGVAHDFNN
VLTAIIGYCDLLLAKHRPSDPSFPDIMQIKQNANRAAGLVRQLLAFSRRQTLRPQVIELG
DVISDAAALLRRLIGERITLDVEHARDLWPVKVDVNQFEQVIVNLAVNARDAMPDGGTLT
IRTGNVPAAGCAAYGQGLPEGDYVMVEVVDTGTGIPPDIMDKIFEPFFSTKEVGKGTGLG
LSTVYGIVQQTGGTILADSEMGRGTTFRVFLPRHVAGTEEEEAPKPAEPEPKAGDTTGQG
RRVLLVEDEDAVRAFASRALANRGYEVLAAASGVEALELIEREGKVDLVISDVVMPEMDG
PTLLRELRSREPGLKVIFISGYAEEAFARNLPPSEHFSFLPKPFSLKQLVAAVSETLRA