Protein Info for GFF125 in Xanthobacter sp. DMC5

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF23441: SDR" amino acids 4 to 245 (242 residues), 33.5 bits, see alignment E=7.3e-12 PF00106: adh_short" amino acids 7 to 199 (193 residues), 200.1 bits, see alignment E=6.4e-63 PF08659: KR" amino acids 8 to 184 (177 residues), 75.5 bits, see alignment E=1.3e-24 TIGR01830: 3-oxoacyl-[acyl-carrier-protein] reductase" amino acids 9 to 245 (237 residues), 318.2 bits, see alignment E=2e-99 PF13561: adh_short_C2" amino acids 13 to 244 (232 residues), 211.6 bits, see alignment E=3.3e-66

Best Hits

Swiss-Prot: 64% identical to NODG_RHIS3: Nodulation protein G (nodG) from Rhizobium sp. (strain N33)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 93% identity to xau:Xaut_3115)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF125 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Xanthobacter sp. DMC5)
MFDLTGKTALVTGATGGIGGAIAKALHAQGATVAVSGTRREALDAIAAEMGGERVIVLPC
NLGNTEEVEKLIPAAEEALGGHVDILVNNAGITRDNIFMRLSDEAWDQVIAVNLSAAFRL
SRAAVRTMMRRRSGRIISITSIVGVTGNAGQGNYAAAKAGMIGMSKSLAQEVASRGVTVN
CIAPGFIATPMTDALNEKQREGILKAVPAAKLGTPEDIAAACVYLASNEAAYVTGQTLHV
NGGMAMI