Protein Info for GFF1249 in Sphingobium sp. HT1-2

Annotation: Capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details PF02397: Bac_transf" amino acids 270 to 458 (189 residues), 209.5 bits, see alignment E=1.5e-66

Best Hits

KEGG orthology group: None (inferred from 82% identity to sch:Sphch_0965)

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF1249 Capsular polysaccharide biosynthesis protein (Sphingobium sp. HT1-2)
MSKIDLAIAGTPSRQPATAAFQRNARLWLSLVLLLADMMALAAGFVIGLRVAGIPILSME
VWQPLAGGILVYGTIAFHNQAYNPRCLTSMTASCRSAVMAFAGTLLIFLLVVFSLKVTDN
FSRLGISTGLFFSGALIVMQRVLVVRAVRRHFAEGLFAQLLIIDDGLIPDDVNGMTIVDA
PTLGLRADLDDPYMLHRLGMLLRDFDRVVISCPLERKADWAQMLKGGNILGEIIVPELDP
MAPLAVQSHRGVSTLVVARGPLNLANRAKKRLLDIILTVPVLIALAPLMIAVAVAIRLDS
PGPVFFRQERIGRGNRLFHILKFRSMRVEQCDTAGATSTQRDDNRITRVGRFIRSTSIDE
LPQLLNVLLGEMSLVGPRPHALGSTAEDQLFWQVDRQYWHRHALKPGITGLAQIRGFRGA
TETRRDILNRVEADLEYLHGWSLMRDIGILVGTARVLVHRNAY