Protein Info for GFF1248 in Xanthobacter sp. DMC5

Annotation: NADH-quinone oxidoreductase chain 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01961: NADH (or F420H2) dehydrogenase, subunit C
  • amino acids 34 to 151 (118 residues), 163.7 bits, E=1.3e-52
• PF00329: Complex1_30kDa
  • amino acids 34 to 153 (120 residues), 169.5 bits, E=2.3e-54

Best Hits

Swiss-Prot: 89% identical to NUOC_XANP2: NADH-quinone oxidoreductase subunit C (nuoC) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 89% identity to xau:Xaut_4631)

MetaCyc: 46% identical to MbhK (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism
• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Protein Sequence (209 amino acids)

>GFF1248 NADH-quinone oxidoreductase chain 5 (Xanthobacter sp. DMC5)
MDETLNDLAAHVSGALPGVVIGTEIAYGELALLIEPSQIVKAVTFLRDDPACQFTCIVDV
CGVDYPAREKRFDVVYHLLSVKQNARIRLKVATDEDTPVPSITGVFPGANWFEREAYDMY
GILFTGHPELRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDAQKRVVYEPVRLPQEFRNFD
FLSPWEGVEYVLPGDEKASGQPPAPPKAG