Protein Info for GFF1248 in Xanthobacter sp. DMC5

Annotation: NADH-quinone oxidoreductase chain 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00329: Complex1_30kDa" amino acids 34 to 153 (120 residues), 170.5 bits, see alignment E=1.1e-54 TIGR01961: NADH (or F420H2) dehydrogenase, subunit C" amino acids 34 to 151 (118 residues), 163.7 bits, see alignment E=1.3e-52

Best Hits

Swiss-Prot: 89% identical to NUOC_XANP2: NADH-quinone oxidoreductase subunit C (nuoC) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 89% identity to xau:Xaut_4631)

MetaCyc: 46% identical to MbhK (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF1248 NADH-quinone oxidoreductase chain 5 (Xanthobacter sp. DMC5)
MDETLNDLAAHVSGALPGVVIGTEIAYGELALLIEPSQIVKAVTFLRDDPACQFTCIVDV
CGVDYPAREKRFDVVYHLLSVKQNARIRLKVATDEDTPVPSITGVFPGANWFEREAYDMY
GILFTGHPELRRLLTDYGFDGHPLRKDFPTTGFVEVRYDDAQKRVVYEPVRLPQEFRNFD
FLSPWEGVEYVLPGDEKASGQPPAPPKAG