Protein Info for PS417_06340 in Pseudomonas simiae WCS417

Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF02542: YgbB" amino acids 1 to 154 (154 residues), 234.8 bits, see alignment E=2.9e-74 TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase" amino acids 2 to 155 (154 residues), 238.7 bits, see alignment E=1.4e-75

Best Hits

Swiss-Prot: 99% identical to ISPF_PSEFS: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 99% identity to pfs:PFLU1297)

MetaCyc: 71% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]

Predicted SEED Role

"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 4.6.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBE3 at UniProt or InterPro

Protein Sequence (157 amino acids)

>PS417_06340 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Pseudomonas simiae WCS417)
MRIGHGYDVHRFAEGDFITLGGVRIAHHQGLLAHSDGDVVLHALSDALLGAAALGDIGKH
FPDTDPTFKGADSRVLLRHVVGLIHAKGWKVGNVDNTIVAQAPKMAPHIESMRALIAADL
HIELDQVNVKATTTEKLGFTGREEGIAVHSVALLLRA