Protein Info for GFF1243 in Xanthobacter sp. DMC5

Annotation: NADH-quinone oxidoreductase subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details PF00146: NADHdh" amino acids 18 to 328 (311 residues), 400 bits, see alignment E=3.6e-124

Best Hits

Swiss-Prot: 83% identical to NUOH2_RHOPS: NADH-quinone oxidoreductase subunit H 2 (nuoH2) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 95% identity to xau:Xaut_4626)

MetaCyc: 60% identical to MbhM (Pyrococcus furiosus)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.7.2 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF1243 NADH-quinone oxidoreductase subunit H (Xanthobacter sp. DMC5)
MNWQDTLIQVLIILGQSLALLVALLIFIAFILLADRKIWAAVQLRRGPNVVGPFGLLQSF
ADLLKFVLKEPTIPSGANKAIFLLAPLVTCVLALAAWAVVPIAPGWVIADLNVGVLYIFA
ISSLGVYGIIMGGWASNSKYPFLAALRSAAQMVSYEVSIGFVIITVLMCAGSLNLSEIVE
AQNGRFGFLGWYWLPLLPMFVIFFVSALAETNRPPFDLVEAESELVAGFMTEYGSTPYLL
FMLGEYVAIMTMCAMGTILFLGGWLSPIPFAPFTWVPGLVWFVLKLCFMFFLFAMAKAMV
PRYRYDQLMRLGWKVFLPISLVAVVVVAGVLHFTGTAPQ