Protein Info for PS417_06295 in Pseudomonas simiae WCS417

Annotation: tRNA(Ile)-lysidine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 23 to 202 (180 residues), 173.4 bits, see alignment E=4.9e-55 PF01171: ATP_bind_3" amino acids 23 to 198 (176 residues), 194.3 bits, see alignment E=2.4e-61 PF09179: TilS" amino acids 254 to 319 (66 residues), 52.3 bits, see alignment E=8.5e-18 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 361 to 405 (45 residues), 42.6 bits, see alignment 3.2e-15 PF11734: TilS_C" amino acids 362 to 429 (68 residues), 50.1 bits, see alignment E=2.1e-17

Best Hits

Swiss-Prot: 64% identical to TILS_PSEPF: tRNA(Ile)-lysidine synthase (tilS) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 80% identity to pfs:PFLU1287)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UH63 at UniProt or InterPro

Protein Sequence (439 amino acids)

>PS417_06295 tRNA(Ile)-lysidine synthetase (Pseudomonas simiae WCS417)
MKPTLPATLLRTLAPWRNAPAWHIAFSGGLDSTVLLHLLASLAKLENLPVLSAVHIHHGL
QAAADAWPAHCQSVCDSLGVPLRVMRVQVSPGASLERAARDARYQAFMQVIGAGEVLFTG
QHRDDQAETLIFRLLRGAGVRGLAAMPGYRPLSGGHVVRPLLNTSRGELEAYARQHQLKW
IEDPSNADPRFSRNYLRHHVFPTLTQRWPQAVSSLARTAEHLAEAQGLLDELAQMDLRAA
DQPSAFAWLPLPSLALAPLRELSDARQCNALRHWLAPLTRMPDTDHWASWYALRDAKDDA
QPVWHLADGQLHRCAERIWWLPSAWSAFSDASVRWPDPQNPLELPGNGQLRFIGNVPECP
LVIRYRQGGEIVEVPGRGRRDLKRLLNESGLPGFVRGRLPLVYRGEQLLAVPTVAGAWAS
STDDRQLHWMPQTCDQGLS