Protein Info for PS417_06270 in Pseudomonas simiae WCS417

Annotation: UDP-N-acetylglucosamine acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 4 to 256 (253 residues), 308.7 bits, see alignment E=1.3e-96 PF00132: Hexapep" amino acids 105 to 137 (33 residues), 31.5 bits, see alignment 1e-11 PF13720: Acetyltransf_11" amino acids 176 to 256 (81 residues), 89.2 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 99% identical to LPXA_PSEFS: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 99% identity to pfs:PFLU1282)

MetaCyc: 49% identical to acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5W0 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PS417_06270 UDP-N-acetylglucosamine acyltransferase (Pseudomonas simiae WCS417)
MSLIDPRAIIDPSAVLAADVEVGPWSIIGAGVEIGEGTVIGPHVILKGPTRIGKHNRIYQ
FSSVGEDTPDMKYKGEETRLVIGDHNIIREGVTIHRGTVQDRAETTLGDHNLVMAYAHIG
HDSVIGNHCILVNNTALAGHVHVDDWAILSGFTLVHQYCHIGAHSFSGMGTAIGKDVPAF
VTVFGNPAEARSMNFEGMRRRGFSEDAIHALRRAYKVVYRQGLTVEQALTQLAEPAALFP
EVAVFRDSIQASTRGITR