Protein Info for PS417_06260 in Pseudomonas simiae WCS417

Annotation: UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 9 to 330 (322 residues), 383.8 bits, see alignment E=2.8e-119 PF04613: LpxD" amino acids 25 to 90 (66 residues), 80.6 bits, see alignment E=8.9e-27 PF00132: Hexapep" amino acids 117 to 150 (34 residues), 27.4 bits, see alignment 2.9e-10 amino acids 147 to 181 (35 residues), 30.2 bits, see alignment 3.8e-11 amino acids 223 to 258 (36 residues), 29 bits, see alignment 9.6e-11

Best Hits

Swiss-Prot: 99% identical to LPXD_PSEFS: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 99% identity to pfs:PFLU1280)

MetaCyc: 50% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Escherichia coli K-12 substr. MG1655)
UDPHYDROXYMYRGLUCOSAMNACETYLTRANS-RXN [EC: 2.3.1.191]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0L1 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PS417_06260 UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase (Pseudomonas simiae WCS417)
MTATIKLGELAEFLGATLRGSPEKEITGLATLQEAGPAQLSFLANPQYRKYLVDSQAAAV
LLKAADAEGFAGDALVVPDPYLAYARVSHLFDPKPKAAAGIHPSAVVADDAQVDPAASIG
AFAVIESGARIAAGVTVGAHCFIGARCEIGAGGWLAPRVTLYHDVRIGERVVIQSGAVIG
GEGFGFANAKGIWNKIAQVGGVLIGDDVEIGVNTAVDRGALADTVIGNGVKLDNQIQIAH
NVQIGDHTAMAACVGISGSTKIGKHCMLAGGVGLVGHIDICDNVFITGMTMVTHSITEPG
AYSSGTAMQPAAEWRKSAARLRQLDDMARRLKQLEKRVGDVTPGGNASSEG