Protein Info for PS417_06250 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 751 to 773 (23 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 23 to 795 (773 residues), 857.3 bits, see alignment E=5.6e-262 PF07244: POTRA" amino acids 92 to 171 (80 residues), 56.1 bits, see alignment E=7.4e-19 amino acids 176 to 262 (87 residues), 67.6 bits, see alignment E=1.9e-22 amino acids 265 to 343 (79 residues), 58.6 bits, see alignment E=1.2e-19 amino acids 347 to 419 (73 residues), 55.2 bits, see alignment E=1.4e-18 PF01103: Omp85" amino acids 447 to 795 (349 residues), 322.8 bits, see alignment E=4.8e-100

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 100% identity to pfs:PFLU1278)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVF4 at UniProt or InterPro

Protein Sequence (795 amino acids)

>PS417_06250 membrane protein (Pseudomonas simiae WCS417)
MKRLLLTAVLTVLMIAEVHAESFTISDIRVNGLQRVSAGSVFGALPLNVGEQADDRRLVE
STRALFKTGFFQDIQLGREGNVLVITVVERPSVASIEIEGNKAISTEDLMKGLKQSGLAE
GEIFQRATLEGVRNELQRQYVAQGRYSATVETEVVPQPRNRVGLKVNINEGTVAAIQHIN
VVGNTKFADEDLIDLFELKTTNWLSFFKNDDKYAREKLSGDLERLRSYYLDRGYINMDIA
STQVSITPDKKHVYITVNVNEGEKYKVRDVKLSGDLKVPEDQVKALLLVQKDQVFSRKLM
TTTSELITRRLGNEGYTFANVNGVPTPHDDDHTVDITFVVDPGKRAYVNRINFRGNTKSA
DEVLRREMRQMEGGWASTYLIDQSKTRLERLGFFKEVNVETPAVPGVDDQVDVNYAVEEQ
ASGSITASVGFAQSAGLILGGSITQNNFLGTGNRVSIGLTRSEYQSRYNFGYTDPYWTAD
GVSLGYNAFYRTTDYKDLDVDVASYAIDSLGAGVNVGYPISETSRLTFGLTAQQDEIKTG
VYTVDEIFDFTRREGDKFLNFKASAGWSESTLNKGVLATRGHSQSLTLETTTPGSDLSFF
KLDYRGQLFTPLSDNYTMRLHTELGYGDGYGSTNGLPFYENYYAGGFNSVRGFKDSTLGP
RGTPSRGVGVTGNQGTVADSDNDPLPFGGNVLIQGGAEILFPLPFVKDQRSLRTSVFWDV
GNVFDSKCEQIKNPSGVKSNTQCNDVSLSNLASSVGVGVTWVTALGPLSFALAMPIKKPD
NAETQIFQFSLGQTF