Protein Info for PS417_06240 in Pseudomonas simiae WCS417

Annotation: 1-deoxy-D-xylulose 5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 5 to 389 (385 residues), 498.8 bits, E=5e-154
• PF02670: DXP_reductoisom
  • amino acids 7 to 135 (129 residues), 149.1 bits, E=1.7e-47
• PF08436: DXP_redisom_C
  • amino acids 149 to 237 (89 residues), 127.6 bits, E=2.4e-41
• PF13288: DXPR_C
  • amino acids 269 to 385 (117 residues), 145.2 bits, E=1.5e-46

Best Hits

Swiss-Prot: 97% identical to DXR_PSEFS: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 97% identity to pfs:PFLU1276)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

See A0A1N7UBC2 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PS417_06240 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Pseudomonas simiae WCS417)
MSRLQQVTVLGATGSVGLSTLDVIARHPDRYQVFALTGFTRLSELLALCVRHAPRFAVVP
EGAAARGLQDDLRAAGLATQVLVGEQGLCQVSADAEVDTVVAAIVGAAGLRPTLAAVDAG
KKILLANKEALVMSGALFMQAVRKSGAVLLPLDSEHNAIFQCMPGDFARGLSQVGVRRIL
LTASGGPFRQTPLAELEHVSPDQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAR
PDQVEVVIHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAV
ARLDFEAPDEQRFPCLRLARQAAEAGNSAPAMLNAANEVAVAAFLERRIRFPQIASIIED
VLALEPVVAVNDLAAVFEADTKARALAEQWLNRNAR