Protein Info for GFF1225 in Xanthobacter sp. DMC5

Annotation: Na(+)/H(+) antiporter subunit E1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details PF01899: MNHE" amino acids 13 to 161 (149 residues), 141.6 bits, see alignment E=8.1e-46

Best Hits

KEGG orthology group: K05562, multicomponent K+:H+ antiporter subunit E (inferred from 61% identity to rpd:RPD_0673)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>GFF1225 Na(+)/H(+) antiporter subunit E1 (Xanthobacter sp. DMC5)
MRARLLPHPLLTLLLILVFIFLMNEATPGVVVLGIVLGIVIPLLTAPFWPGRPRLKAPLT
IASYVLIVLWDIVRSNVEVAGIILFRPAERLRTRYVTVPLDIVTPEAIAVLAGTITMTPG
TVSADLSADGRALLVHCLDAGDPEGAVAAIKARYESRLKRIFE