Protein Info for GFF1224 in Xanthobacter sp. DMC5

Annotation: Na(+)/H(+) antiporter subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 126 to 153 (28 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details amino acids 418 to 444 (27 residues), see Phobius details amino acids 457 to 477 (21 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 133 to 428 (296 residues), 126.2 bits, see alignment E=7.7e-41

Best Hits

KEGG orthology group: K05561, multicomponent K+:H+ antiporter subunit D (inferred from 62% identity to rpe:RPE_3871)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>GFF1224 Na(+)/H(+) antiporter subunit D (Xanthobacter sp. DMC5)
VTPAISTLDHAIILPVLLPALTAAFLVLALRHHLRRQRIVSLAATGLLLALAIVLFALAS
DGTVRAYRLGDWPAPYGITLVLDRLSATMLLLTAVLAGCVLIYASGGVDGRGRHFHPLFQ
FQLMGINGAFLTGDVFNLFVFFEVMLIASYGLMLHGGGPGRLKAGFQYVAINLLASAVFL
VGVGLIYAVTGTLNMADLAVKVPQVAPADAALLKTGALLLFLVFATKAALVPLHWWLPAT
YAGTSAPAAALFMIMTKVGAYAIIRVYGLVFGAGAGPLALAADPFVMPAALATLVVGTVG
LVGSRTLRDLSAFAVIASMGTLLIAVGLFDVEGLSAGLYYLVHSTLAGAALFLIAGIVQE
QRGAASDRLIPAPAMGGETLLGGLFFLAAIALVGLPPLSGFIGKVMILQAVRTSAIWPWI
WAAILGASLLMTFGFARAGSVLFWASGPVSERKPLPALPGLAAVMLLLAAIVGWALAAGP
ATQALSLAARQVLDRNSYIEAVLPPGPPAAPEK