Protein Info for GFF1224 in Sphingobium sp. HT1-2

Annotation: PTS system, N-acetylglucosamine-specific IIC component / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.193) / PTS system, inactive IIB catalytic domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 42 to 70 (29 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 184 to 212 (29 residues), see Phobius details amino acids 214 to 215 (2 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 11 to 471 (461 residues), 612.8 bits, see alignment E=4.3e-188 PF02378: PTS_EIIC" amino acids 17 to 317 (301 residues), 229.4 bits, see alignment E=5.9e-72 TIGR00826: PTS system, glucose-like IIB component" amino acids 374 to 460 (87 residues), 59.5 bits, see alignment E=3.2e-20 PF00367: PTS_EIIB" amino acids 404 to 435 (32 residues), 42.9 bits, see alignment (E = 2.6e-15)

Best Hits

KEGG orthology group: K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 65% identity to cse:Cseg_3140)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component (EC 2.7.1.69)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>GFF1224 PTS system, N-acetylglucosamine-specific IIC component / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.193) / PTS system, inactive IIB catalytic domain (Sphingobium sp. HT1-2)
MSFRPATLLARLQPLGRALMLPIAVLPIAALLLRLGQPDMLAIPFVAAAGDAIFSNLGLL
FAAGVAVGLARENHGAASLAGVIAYLVTTEGAKVLLVLPPDVAEAAQAAWRAKEIAKVSV
PAGILSGIVAGLLYNRFSDIKLPDYLAFFAGRRFVPIVAGLAGLFGALMFGLGFPWIEAG
IDRLSQWVVAAGPLGLFVYGLLNRLLLITGLHHIINNVAWFLLGDFHGATGDIKRFFAGD
PTAGGFMSGFFPVMMFGLPAACLAMYRTALPDRRKRVGGLLLSLALTSFLTGVTEPIEFS
FIFLAPILYVVHAVLTGLSMVVMDALGVKLGFGFSAGLFDYLMNYGLATKPLMLIPVGIV
YFAVYYATFSWCIRRFNLKTPGREDEPAAAAEMPSVAGARGPAMVAALGGKANVRSVDAC
TTRLRLVLGDSTIADEARLRALGARGVVRLRDGGFQVVLGPIADQVAAEIRSALAGHDPA
PIAGTSDLVALLKRAGVRAVEQRGTRLLVRVDRPAAVDAAALQGAGVKAWVLPASADGWL
HLILGDQVEPLADALRAA