Protein Info for GFF122 in Variovorax sp. SCN45

Annotation: Dihydroorotate dehydrogenase electron transfer subunit (EC 1.3.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF10418: DHODB_Fe-S_bind" amino acids 244 to 284 (41 residues), 52.5 bits, see alignment 1.6e-18

Best Hits

KEGG orthology group: K02823, dihydroorotate dehydrogenase electron transfer subunit (inferred from 67% identity to bgf:BC1003_5002)

Predicted SEED Role

"Dihydroorotate dehydrogenase electron transfer subunit (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.3.1

Use Curated BLAST to search for 1.3.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF122 Dihydroorotate dehydrogenase electron transfer subunit (EC 1.3.3.1) (Variovorax sp. SCN45)
MNFALSLAMEQTPACFQRNAETVASHRCEVTEHRWVNDRYRYLRLSAGADLAGTTKPGQF
YQLRCPQTQDSQPFLLRPMSVYGMGPEAGAIEFLYNVTGAGTRALASLEVGGHMDIVGPL
GNTFAMEPDFERILVVARGVGLATMAPLLQQAAKAGVKITAVMSARAPKDLMRDEFLRGI
DADVHCVYDSDGSSSVEAMDVLLRRLLDAARHDVVYTCGSHRILMLLQRVLEDYPHTRGE
VAMEQRMACGMGVCLSCVRLFDKDGDKQFLRVCREGPVFSIRDVVGEVEFG