Protein Info for GFF1219 in Xanthobacter sp. DMC5

Annotation: Dipeptide transport system permease protein DppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 187 to 195 (9 residues), see Phobius details amino acids 203 to 203 (1 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 258 to 284 (27 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 16 to 108 (93 residues), 36.7 bits, see alignment E=4.3e-13 PF00528: BPD_transp_1" amino acids 120 to 341 (222 residues), 137.8 bits, see alignment E=3.6e-44

Best Hits

Swiss-Prot: 44% identical to DDPB_ECOLI: Probable D,D-dipeptide transport system permease protein DdpB (ddpB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 74% identity to azc:AZC_1958)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>GFF1219 Dipeptide transport system permease protein DppB (Xanthobacter sp. DMC5)
MSALLNIGRRVGKHLLASLPALFGVVLFTFLLMRVLPGDPAAFFASGPNAGQAEMAQIRE
TMGLDRPIPEQFVRYVGDLARGNLGQSMTTGQPVIADLAERMPASLELTVFALVLALALA
LPLGILAALRPNSLLDHGVRFVCTLGVCVPTFVTGLLLIYVFYYLLGIAPDPTGRVDVFA
APPPGITGFLLIDFLLVGDLAGWKAAFGQLILPACTMALFVLAPLARMTRASLLAVLGSD
FIRTARSVGMSDWRVVVVYALRNALLPVLTIIGIVFSTMLGANVLVEKVFSWPGIGSYAL
DALLASDYAPVQGFVLLIAVIFVMVNLIIDVLYGIVDPRISLQ