Protein Info for GFF1218 in Xanthobacter sp. DMC5

Annotation: putative D,D-dipeptide transport system permease protein DdpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details PF12911: OppC_N" amino acids 8 to 55 (48 residues), 29.1 bits, see alignment 7.8e-11 PF00528: BPD_transp_1" amino acids 96 to 280 (185 residues), 116.4 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 43% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 81% identity to bra:BRADO1799)

MetaCyc: 43% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2); Putative hemine transporter ATP-binding subunit" (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>GFF1218 putative D,D-dipeptide transport system permease protein DdpC (Xanthobacter sp. DMC5)
MSATLRHAGWVLRGNPVTACAAAGAVVLVAIAVLAPWITPYDPIASNVPAALQPPSAAHW
AGTDQLGRDIFSRLIAATRLDLGIAVSAVLLSFVAGATIGALCGYAGGRVDRSVGRLVDV
LMAFPLFVLAMALVAALGNRVENIVIATALINLPFYIRFARAEVNVRRHAGWVEAARAGG
ESHATIVLAYLLPNILPAMAVQISLNLGWAILNAAGLSFLGLGVQAPTPEWGIMVAEGAR
FIGNGQWWLVAFPGLALMLAVLCFNLLGDGLRDILDPRMRT