Protein Info for GFF1212 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Kappa-fimbriae usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13954: PapC_N" amino acids 31 to 166 (136 residues), 87 bits, see alignment E=1.3e-28 PF00577: Usher" amino acids 177 to 719 (543 residues), 566.7 bits, see alignment E=6.5e-174

Best Hits

Swiss-Prot: 100% identical to PEFC_SALTY: Outer membrane usher protein PefC (pefC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to stm:PSLT017)

Predicted SEED Role

"Kappa-fimbriae usher protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (802 amino acids)

>GFF1212 Kappa-fimbriae usher protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSFHHRVFKLSALSLALFSHLSFASTDSELNLDFLQGMSAIPSVLKSGSDFPAGQYYVDV
IVNQENVGKARLSITPQEESANALCLSPEWLKAAGVPVRLEGYASTLNAAGQCYVLSRNP
YTRVDFSYGSQSLVFSIPQSFLVGKTDPSRWDYGVPAARLKYSANASQTSGQSTSAYANA
DLMVNLGRWVLASNMSASRYADGSGEFTARDITLSTAISQVQGDLLLGKSQTRSALFSDF
GFYGAALRSNSNMLPWEARGYAPLITGVANSTSRVTISQNGYAVYSKVVPPGPYQLDDVR
SVGNGDLVVTVEDASGHKTTTVYPVTTLPTLLRPGEVEYNVAVGRKSSNYKLKKPFADGE
NGMFWMGSVGYGFDSTTLNAASILHGKYQAGGVSVTQALGGFGAVSAGMNLSQAKYDNGD
NKRGHSVSAKYAKSFSDSSDLQLLAYRYQSKGYVEFADFYSTDRYTRYNTKSRYEMRFSQ
RLGNSNLNLAGWQEDYWWMKGKAIGGDVSLSTTILDGVSVFLNGSYSKRPYLDKPDYSTS
LSFSIPFTLGGVRHYSSTGLSYSSSGRMGMNSGVSASPTDRLSYGLNTNLSDKGDRSLSG
NLSYGFDAIQTNMMLSQGRDNTTVSGSVSGTILGTADSGLMMTKETGNTLGVARIPGVKG
VRINGSAPTNSKGYTVVNLSDYSLNRVSVDMENVPDDLELQTTSFNVVPTEKAVVYREFG
AEHVLRYILRVKERDGRILNGGSAQTEQGLDAGFIAGNGVLLMNMLSAPSRVSVERGDGS
VCHFSVKGIVPNTGKVQEVYCE