Protein Info for PS417_06155 in Pseudomonas simiae WCS417

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 95% identical to DAPE_PSEF5: Succinyl-diaminopimelate desuccinylase (dapE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 98% identity to pfs:PFLU1259)

MetaCyc: 59% identical to succinyl-diaminopimelate desuccinylase (Escherichia coli K-12 substr. MG1655)
Succinyl-diaminopimelate desuccinylase. [EC: 3.5.1.18]

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

aspartate superpathway (22/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
L-lysine biosynthesis I (9/9 steps found)

KEGG Metabolic Maps

Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U815 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PS417_06155 succinyl-diaminopimelate desuccinylase (Pseudomonas simiae WCS417)
MTAHADLSPTLQLAIDLIRRPSVTPIDADCQKLMMQRLGDAGFALEPMRIEDVDNFWATH
GKHDGPVLCFAGHTDVVPTGPVQAWQNDPFDALIDENGMLCGRGAADMKGSLAAMLVAAE
RFVTDYPDHKGSVAFLITSDEEGPAHHGTKAVIERLAARKERLDWCIVGEPSSTTLVGDV
VKNGRRGSLGATLTVRGIQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQ
ISNLNSGTGATNVIPGDLKAVFNFRFSTESTVEGLQQRVAEILDKHGLDWHVEWALSGLP
FLTEPGALLDAVSASIKAITGRETQASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNE
RILASDLDVLTEIYYQTLIKLLA