Protein Info for GFF1207 in Xanthobacter sp. DMC5

Annotation: putative anti-sigma-F factor NrsF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details PF06532: NrsF" amino acids 10 to 212 (203 residues), 174 bits, see alignment E=1.8e-55

Best Hits

KEGG orthology group: None (inferred from 65% identity to xau:Xaut_0957)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>GFF1207 putative anti-sigma-F factor NrsF (Xanthobacter sp. DMC5)
MNTDDLIDFLATRVEAVDPGRQDRLLTLAMAGSLCLAAVACIFALGVRPDLLRAVGTFGF
VLKVGFLATMVGIAAHGLRRAARAGRASGKLLRLALLPLALVWFAAVMQIVATPATSGMA
TMFNDWYVCVLAIPLLSVIPLVVLTLVLRETAPTDLHYCGALLGLVAGGIGALAYASFCV
NDAPVYVGIWYAAGLAIVTGFGWLTGPRFLKW