Protein Info for GFF1206 in Xanthobacter sp. DMC5

Annotation: ECF RNA polymerase sigma factor SigF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF07638: Sigma70_ECF" amino acids 6 to 164 (159 residues), 46.4 bits, see alignment E=8.7e-16 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 21 to 175 (155 residues), 66.6 bits, see alignment E=1e-22 PF04542: Sigma70_r2" amino acids 32 to 96 (65 residues), 41.2 bits, see alignment E=2.2e-14 PF08281: Sigma70_r4_2" amino acids 122 to 174 (53 residues), 39.4 bits, see alignment E=7.6e-14 PF04545: Sigma70_r4" amino acids 127 to 174 (48 residues), 24.4 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 45% identical to SIGF_AZOOP: ECF RNA polymerase sigma factor SigF (sigF) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 87% identity to xau:Xaut_0958)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>GFF1206 ECF RNA polymerase sigma factor SigF (Xanthobacter sp. DMC5)
MSRETDLEALMRASQSGDAEAHRALLQHLSVRLRSYFRNRLRRSGAGADDAEDLVQDTLL
VLHTKRHTYDGSSPVLAWTYGIARYKLIDHLRLNARSLRNVQIDDMDDLADVDRYEAVDT
SRELHRALETLPRHFRLPIEYVKIEGLSIAEAAARIGMTDAAVKIGIHRGMKKLAALLSE
ARP