Protein Info for GFF1204 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 53 to 80 (28 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 394 to 419 (26 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details amino acids 497 to 516 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>GFF1204 hypothetical protein (Xanthobacter sp. DMC5)
MVSLPSLLSCIPLALLLWVTPGWFLARGLGQGRTAALALAPALGWATQTPAALALAHLFG
LSPAVVIGSAALVSLCALALPRASAGARFPLLALAFAGLLALVPMLGVLPKVMPDGAIAL
ASPIYDHAKIILIDEIAQNGTIPPANPVFGAGGAAGTVAYYYLWHFGAAELAILSGAHGW
AADAAATWFTGFAALALVGTLAFRLRPGMSAPLLALLAASAGSLRPVAAALFGGARLDLA
LEPASGLAGLLYQTSWSPHHVASATACVIAVLLMTRLRTGSGVGQGAVLAGLIGLAAAAA
FGSSLWVGGVTFALAGTAAALVLAFSRPAKGRLRFLAALAGAALMTLVLVAPLLMAQIHA
AAARGGGTPLLLAPLPVLGPGWTEAARAVLDPLAYWLVLLPVEFPAILFAGVAGLALVLA
GRTGGKPARRLAPPLAVLAVVALAVSATLQSTAGENNDLGWRAVLPAILVLAAFAGAALS
AALSWAMQSMRARQGRVGLAVGLALVALGLPDTFALTHRNIVGEPSTDGRVFADDPALWR
AVRRQIGPEVRIASNPARLEKLTPWPINLSWALLSRRRSCFGGPEMALAFAPLSAAERAE
AAMLFERVFAGTGTAEDVATLRRTFGCGAIVVTAQDGAWSADPFASSPLYRLVEEEDGRW
RIYVASEPVR