Protein Info for PS417_06110 in Pseudomonas simiae WCS417

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 352 (313 residues), 253.1 bits, see alignment E=1.7e-79 PF25973: BSH_CzcB" amino acids 64 to 198 (135 residues), 33.1 bits, see alignment E=1.3e-11 PF25917: BSH_RND" amino acids 64 to 197 (134 residues), 43.6 bits, see alignment E=6.7e-15 PF25876: HH_MFP_RND" amino acids 98 to 163 (66 residues), 30.2 bits, see alignment E=1.3e-10 PF25954: Beta-barrel_RND_2" amino acids 207 to 260 (54 residues), 36.7 bits, see alignment 1.2e-12 PF25967: RND-MFP_C" amino acids 286 to 340 (55 residues), 23.6 bits, see alignment 1.2e-08

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU1250)

Predicted SEED Role

"RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0I9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>PS417_06110 RND transporter (Pseudomonas simiae WCS417)
MRSTFLPFALPVSLVFLLAGCGHEEAAQTTIRPAMVVQPQPSSQSMDSYPGEVRARYEPD
LAFRIGGKVSKRLVEEGERVKANQALAELDPQDVRLQLEATRAQVAGAEANLSLVRAERD
RYKTLMDRQMVSRSQYDNSENLYRAGVARLKQIKAEFDVASNQAGYAVLRAPQDGVVAKR
VVEVGQVVSAGQTVFTLATDGEREVLISLPEQGFGRFKIGQPVSVELWSQPDQRFTGRIR
ELSPAADPKSRTFAARVAFTGGKVPAELGQSARVFIQVDGDIPLSVPLSALSAENGASYV
WRVQPDNTLKRTPVRIGAFGEKTVPVLEGLSPTDWVIAAGVHVLHEGQQVRPVDRSNRVV
NLAAKE