Protein Info for GFF12 in Xanthobacter sp. DMC5

Annotation: Ribosomal RNA small subunit methyltransferase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22458: RsmF-B_ferredox
  • amino acids 148 to 216 (69 residues), 41.8 bits, E=2.9e-14
• PF01209: Ubie_methyltran
  • amino acids 240 to 324 (85 residues), 30.9 bits, E=5.5e-11
• PF01189: Methyltr_RsmB-F
  • amino acids 242 to 439 (198 residues), 166.5 bits, E=1.9e-52
• PF13847: Methyltransf_31
  • amino acids 247 to 385 (139 residues), 38.3 bits, E=3.2e-13
• PF01728: FtsJ
  • amino acids 247 to 394 (148 residues), 25.9 bits, E=2.6e-09

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 76% identity to azc:AZC_3182)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (454 amino acids)

>GFF12 Ribosomal RNA small subunit methyltransferase B (Xanthobacter sp. DMC5)
MVRPRFQPDRVSVSFAAILQATLDLTEEVDAVARPADAVVSDFFRTRRDIPAPQRGPISE
LLYILLRHHARLGWWLKRHGRPDTPRNRLLAWLVLGAGKTRDQVQALFSGVKFGPAPLTD
QERALLVKLQGARIDHPSMPEDVRYECPEWGAEGLHRRFGEDFPQEMAAMLTPAPLDLRV
NPIKADRVQMLSALRALGLPAELSPLSPYGIRVNERPALNRLAMLKTGELEIQDEGSQLV
AVVVDAKPGERVVDFCAGAGGKTLAIAAQMKNKGHVIACDVLENRLKRAAERFRRAGLHN
IETRPLASETDRWVKRHKGGFDRVLVDAPCSGTGTWRRNPDARWRVLGPGLDALLPLQAR
ILASAARLVKPGGRLVYATCSLLAEENEEQVAAFLAAHPAFRVVPLSEVAPQITGSAHPD
YLALTPARHDTDGFFAAVLEREAAPIPEAAPIPE