Protein Info for GFF1195 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sigma-54 dependent response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00072: Response_reg" amino acids 22 to 132 (111 residues), 88.3 bits, see alignment E=1.6e-28 PF00158: Sigma54_activat" amino acids 161 to 327 (167 residues), 221.4 bits, see alignment E=2.4e-69 PF14532: Sigma54_activ_2" amino acids 162 to 332 (171 residues), 65.8 bits, see alignment E=2.2e-21 PF07728: AAA_5" amino acids 185 to 305 (121 residues), 41.9 bits, see alignment E=4e-14 PF00004: AAA" amino acids 185 to 321 (137 residues), 24.6 bits, see alignment E=1.2e-08 PF25601: AAA_lid_14" amino acids 333 to 393 (61 residues), 67.3 bits, see alignment E=3.4e-22 PF02954: HTH_8" amino acids 419 to 456 (38 residues), 38.8 bits, see alignment 2.4e-13

Best Hits

KEGG orthology group: None (inferred from 71% identity to mpt:Mpe_A1169)

Predicted SEED Role

"Sigma-54 dependent response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>GFF1195 Sigma-54 dependent response regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
VDTPFLPPSPERTLEGWPDWSILIVDDEQGMLNFLVKTLAPRCHFVMSASSAEDGAQWLR
GHHVDLVILDISLPGKSGVVWLKELREQGFTGEVILITAFADLDTAIEALRAGASDFILK
PFRVPQILNAVKHCYERSRLRRENFVLRRAVVTSAPGRAALVGGSSAMQQLRESIARVAP
VNSTVLLQGESGTGKELVARELHALSSRAGGPFVPVNCAAVSPELIESELFGHAKGAFSG
ATRARDGLFHYAQGGTLFLDEIAELPLSIQATLLRAIEDLNIRPVGSEQLVPLNLRIVAA
TNRQLSEEVAAGRFRKDLYFRLQVVDLALPPLREHKEDIAELVAHFIAQLAPSLGVEPLA
ISEHEMDFLRQYDWPGNVRELRNLLERSLILGNLNVSALYPGVARRPETSSALPTDLHTL
EKMHILSVLDSVQGDKTRAAQLLGVSRRTLERRVAEWGTT