Protein Info for GFF1195 in Methylophilus sp. DMC18

Annotation: Formyltransferase/hydrolase complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01913: FTR
  • amino acids 1 to 148 (148 residues), 200 bits, E=1.7e-63
• TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase
  • amino acids 8 to 299 (292 residues), 439.6 bits, E=2.8e-136
• PF02741: FTR_C
  • amino acids 151 to 300 (150 residues), 211.2 bits, E=7.3e-67

Best Hits

Swiss-Prot: 74% identical to FTR_METFK: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ffsA) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 80% identity to mmb:Mmol_0859)

MetaCyc: 55% identical to formyltransferase/hydrolase complex delta subunit (Methylorubrum extorquens AM1)
RXN-2884

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

• methyl-coenzyme M oxidation to CO₂ II (4/6 steps found)
• formaldehyde oxidation VI (H₄MPT pathway) (2/4 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (12/18 steps found)
• methanogenesis from H₂ and CO₂ (3/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (3/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (3/6 steps found)
• methoxylated aromatic compound degradation II (4/9 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)
• superpathway of methanogenesis (4/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.101

Protein Sequence (308 amino acids)

>GFF1195 Formyltransferase/hydrolase complex subunit D (Methylophilus sp. DMC18)
MQLNGVDIDDTFAEAFNMRGTRILITAQNLRWAYNAANAMTGFATSVIGCGVEAGIEREL
SEDETPDGRPGVSVLMFAMGSKVLMQQLETRMGQCILTCPTAAAFAGIESEDMISLGKHL
RFFGDGYQVSKQIPDATGKLKRYWRIPVMDGEFLTEETTGMVRAIGGGNFLVLGASQAQV
LTACEAAIDAMRKLPNVIMPFPGGVVRSGSKVGSKYPKMFASTNDAFCPTLKGVVKSELD
PRVESVMEIVVNGLTFEDIAVSMKAGIEAACSLGKDNGILRISAGNYGGKLGQHHFKLRP
ILSGEVTA