Protein Info for GFF1195 in Methylophilus sp. DMC18

Annotation: Formyltransferase/hydrolase complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF01913: FTR" amino acids 1 to 148 (148 residues), 200 bits, see alignment E=1.7e-63 TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase" amino acids 8 to 299 (292 residues), 439.6 bits, see alignment E=2.8e-136 PF02741: FTR_C" amino acids 151 to 300 (150 residues), 211.2 bits, see alignment E=7.3e-67

Best Hits

Swiss-Prot: 74% identical to FTR_METFK: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ffsA) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 80% identity to mmb:Mmol_0859)

MetaCyc: 55% identical to formyltransferase/hydrolase complex delta subunit (Methylorubrum extorquens AM1)
RXN-2884

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.101

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF1195 Formyltransferase/hydrolase complex subunit D (Methylophilus sp. DMC18)
MQLNGVDIDDTFAEAFNMRGTRILITAQNLRWAYNAANAMTGFATSVIGCGVEAGIEREL
SEDETPDGRPGVSVLMFAMGSKVLMQQLETRMGQCILTCPTAAAFAGIESEDMISLGKHL
RFFGDGYQVSKQIPDATGKLKRYWRIPVMDGEFLTEETTGMVRAIGGGNFLVLGASQAQV
LTACEAAIDAMRKLPNVIMPFPGGVVRSGSKVGSKYPKMFASTNDAFCPTLKGVVKSELD
PRVESVMEIVVNGLTFEDIAVSMKAGIEAACSLGKDNGILRISAGNYGGKLGQHHFKLRP
ILSGEVTA