Protein Info for GFF1193 in Sphingobium sp. HT1-2

Annotation: Uncharacterized amino acid permease, GabP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 27 to 437 (411 residues), 191.8 bits, see alignment E=3.2e-60 PF00324: AA_permease" amino acids 31 to 407 (377 residues), 133.6 bits, see alignment E=1.4e-42 PF13906: AA_permease_C" amino acids 415 to 462 (48 residues), 29.3 bits, see alignment 1.1e-10

Best Hits

Swiss-Prot: 38% identical to MTRTR_BACSU: Methylthioribose transporter (mtrA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 64% identity to xcv:XCV4466)

Predicted SEED Role

"amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>GFF1193 Uncharacterized amino acid permease, GabP family (Sphingobium sp. HT1-2)
LSTGFWGPIKPIGASHHAQHQQLRKTLSWPHLIALGVGAIVGTGIYTLTGVGADRAGPAV
ILAFAIAGAVCACAALAYAELATLIPTAGSAYTYTYSVLGETLAWVVGWSLILEYSLACS
TVAVGWSGYLVGWIQQAGISLPPVLLAGPHGGGIVNLPAVLVALAIAGMLIAGTRESATL
NIILVVIKLTALAAFVALALPAFQSDHLQPFMPYGFVSHVEGGMTRGVMAAAAIVFFAFY
GFDAVATSAEEARNPGRDLTIGIVGSMAVCTLIYMAVAVAAIGALDYRALAGSSEPLALV
LRTLEHPVAAWLVAGAALVALPSVILVMMYGQSRIFFVMARDGLLPRSLSKVSEKTGSPA
RITAITGVFVAAVAGFFRLDEIAELANAGTLIAFIAVAGCMMALRRKAPEMPRVFRCPQP
YLVGTLAIVGCIYLLISLPEKTLLRFGLWNLVGLALYFAYSRGRSLLRTTGYAASEEGLP
E