Protein Info for GFF1188 in Sphingobium sp. HT1-2

Annotation: Amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 984 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07676: PD40" amino acids 76 to 110 (35 residues), 36.8 bits, see alignment (E = 9.8e-13) amino acids 120 to 154 (35 residues), 49.3 bits, see alignment (E = 1.2e-16) amino acids 164 to 198 (35 residues), 23.2 bits, see alignment (E = 1.9e-08) amino acids 318 to 330 (13 residues), 14 bits, see alignment (E = 1.4e-05) amino acids 348 to 382 (35 residues), 34.6 bits, see alignment (E = 4.8e-12) amino acids 447 to 459 (13 residues), 13 bits, see alignment (E = 3e-05) amino acids 505 to 517 (13 residues), 12 bits, see alignment (E = 6e-05) PF01979: Amidohydro_1" amino acids 647 to 970 (324 residues), 76.4 bits, see alignment E=8.9e-25

Best Hits

KEGG orthology group: None (inferred from 80% identity to sjp:SJA_C2-01810)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (984 amino acids)

>GFF1188 Amidohydrolase (Sphingobium sp. HT1-2)
MKSAFKLLSLALLSAGAVQAYAQPANLPPPGGETPVAFDVHEGTSMAVSVSPDGKWLAVD
LQGSLWIIPTSGGKAKRITDYFNDARQPVWSPDGSRLAYFSYRDGNYDLWTIKPDGSDMR
KLTEGAYDDREPAWSPDGRTIAFSSDRSGNYDIWTLDIASGAMKQVSSNGREDRMPSWSP
DGARIAYSGTDGAKTALYVTALADGQESLLKQVQGKIDAPSFGPGGELAYVVQDAQGSRL
EVDGKAVSGAENVFPFRVSWGKGSYYYVSDGKIRSRKGTSLSTVNFAATLEVVKPSYARA
KRDWDSTAPRKALGIVHPTLSPDGSRIAFAALGDLYVMSSKGGVPENLTKDGALDTDPAW
SPDGQSLVYTSDKGGGLPQLWIRDMKTGKDRRLTDIDTQPLGAAWSHDGTRIAYIDVDGR
WGVAGLCVVDVATGKITRLQGSLGQPGSPSWSPDGKYVAIPLSYKYSNSFREGTNQVYMV
PTDGVGKPFWHLPEPNMSMDTRAGGGPAWSPDGTKMAAIYEGLLKIWPVAADGKPLGPPR
SYTSDISYFPSWAGDNKTILFQSADKLKSLDTETGAITDIPLDLTYRIANPTGRTVIHVS
NLVDSVHDVTQHDKDIIVDGHRIAEIRDHDPALHQAEHFVDGTGLTAIPGLIEHHSHAQK
DFGSNLERAWLAYGITTVRDPGTQIYDAVEDREAAESGVRLSPRLYVAGPLLEWQRVYYK
MGVAVSSPAHLEREFTRMRALHYDMIKSYVRMPDLFQRQIVRAAHEMGIPVSGHEIFPAA
FSGVDGTEHMGATSRRGYSPKQGPQGMAYEDVIQLFGRSGRTLTPTHFGAMTPYLAKHPG
YKDDPRLNLYPVWARETITEADPMASMLRPLLEGQYKSLKKMYDAGTLVTAGTDTMIANN
LHAEISSYVDAGLTPFQALQTATVNSAKDLNLDAGTLEAGKLADIVLVDGDPRADIANTF
KVKKVMMNGVIHDVDDIVAGGMRK