Protein Info for GFF1185 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 PF14742: GDE_N_bis" amino acids 36 to 228 (193 residues), 202.8 bits, see alignment E=9.3e-64 PF22422: MGH1-like_GH" amino acids 313 to 617 (305 residues), 81.9 bits, see alignment E=1.4e-26 PF06202: GDE_C" amino acids 375 to 658 (284 residues), 23.4 bits, see alignment E=5.7e-09 PF17389: Bac_rhamnosid6H" amino acids 382 to 579 (198 residues), 29.4 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 70% identity to xau:Xaut_2711)

Predicted SEED Role

"Glycogen debranching enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>GFF1185 hypothetical protein (Xanthobacter sp. DMC5)
MSPSDAAARAAAADPQEPGYAIAASASQIEAMPRTLKHDETFAVFDAHGDAVPGLASNHG
LFHRDTRHLSQFFLTIDGVRPLLLGSTVRDDNATLSCDLTNPDLPARNGEGELAHDLIHL
RRSRFLFRGACHECLSVRNFDGETRTFEIGLFFDADFVDLFEVRGSHRAKRGRMVAPVVG
ESHVALSYRGLDEHTRTTRLAFAPRPTVLKADRALYRLTLKPGEGFVIFAEIRCDGAEPE
RDARQAFRLGLKDIRADMRIRTARSAGVSSSNDHFNEGLRRAVSDLNVLITDLPEGPYPY
AGVPWFSTVFGRDAIITAFETLWLTPSLARGVLLHLAANQATTFDPEADAEPGKILHEVR
FGEMAELGEVPFRRYYGSIDSTPLFVMLAGAYLERTGDVETVRMLWPAIEAALGWMREHG
DRDGDGFIEYGRRRGDGLVNQGWKDSHDSIFHANGRLAKGPIALVEVQGYAYAAWNAAAA
IARVLRFPDAAEAYAARARALRAAFDAAFFDSTLGTYVLALDGDKAPCRVRTSNAGHALF
SGIALPERAEAVAATLMNSSSFSGWGVRTLAAGEARFNPMSYHNGSVWPHDNAVVALGLA
RYGFRAEAARIFEGLFRASVYFDLRRIPELFCGFARQRNRGPVGYPVACAPQAWAAAAPL
ALLQASLGLSFDVAERRAVFERPMLPEFLDTLTLTGLSVADGHIDVRVERVKASAALSVI
DRQGDVGIRVES