Protein Info for GFF1174 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, IclR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR02431: beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family" amino acids 6 to 256 (251 residues), 297.4 bits, see alignment E=3.7e-93 PF09339: HTH_IclR" amino acids 12 to 62 (51 residues), 47.3 bits, see alignment 1.4e-16 PF01614: IclR_C" amino acids 78 to 252 (175 residues), 115.7 bits, see alignment E=1.8e-37

Best Hits

Swiss-Prot: 52% identical to PCAU_ACIAD: Pca operon regulatory protein (pcaU) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 94% identity to vap:Vapar_2383)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF1174 Transcriptional regulator, IclR family (Variovorax sp. SCN45)
MTIARADFIEGIAKGMAVLESFDTERQRLNATLAAERAGLTRAAARRHLLTLAHLGYLET
DGSYFWMAPKVLRFSGSYLASSRLPRALQPTLNRLAAQTGESFSAVVLDGEEVVIVARSG
NYGTPTRVLAYGLHLGARLPAHATSTGRVLLAAMAPTVFTQWLKGRHLARLTPQTVTQAR
GLRQLVARARKDDYCFASEEHELGVQALAVPLRDMQGHTVAALNVVLSGTRYQEEALQRD
MLPLLFEAAREVRSLL