Protein Info for GFF1173 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 260 to 286 (27 residues), see Phobius details amino acids 299 to 325 (27 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 309 (267 residues), 108.7 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: None (inferred from 53% identity to lch:Lcho_1205)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF1173 hypothetical protein (Xanthobacter sp. DMC5)
MTSPATLTATAPTRSARAPGGLLALAVLGAGCLLPFAGASPLLLSLLVQAIIGAMLATGV
GFLVRQNGMVSFGHALFFGLGGYVLGVPMAHGLLPPEMAVLLALLVPALLAFVLGLVITR
IPGVAFSMLSLACAQTFYEVVLKVRTLANGDDGMSVTFPARLFGLDVGLLQDPRSMYLIC
WALLAAVLVGLWLFTRSPYGLLTLAIRSNEERARFIGYETVVPRAAVYALSAGVAGLAGV
LATFYNGFISPDMMHWTLSGSALVMAVIGGTRAVWGPALGAVVFFFFKEIVGDATEHWPA
VIGITLIVVTLCAPAGLSGLLARLFARRAA