Protein Info for GFF1172 in Xanthobacter sp. DMC5

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 45 to 74 (30 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 216 to 243 (28 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 5 to 270 (266 residues), 115.7 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: None (inferred from 56% identity to pna:Pnap_2713)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF1172 High-affinity branched-chain amino acid transport system permease protein LivH (Xanthobacter sp. DMC5)
LIIHILNGFVYGGLLYLVAIGLVLIFGLRQVVNFAHGSLFMLGAYVGYAATAIAGFWAGV
VVATLVLAVLGLLLDRAVFRPLQDQDPIVTLLVTFGLLLVIEDLVRTVWGKDTLTIAMPD
LLSGTLRIAGEDFPVYRLFVILVAAGMGAGLTLWLKRSRIGLYVRAFASDPLTTGTQGVD
TERVSAAVVALGAGFAGLAGIIAGPLLALSPAMGGSILIASFIVVVVGGFGSFSGAFVAA
LVIGQLQNLGIVFIPSFATMIPFLLMMLILLWRPLGLTGRAA