Protein Info for GFF1171 in Xanthobacter sp. DMC5

Annotation: Dihydroanticapsin 7-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00106: adh_short" amino acids 5 to 195 (191 residues), 177.9 bits, see alignment E=2.6e-56 PF08659: KR" amino acids 7 to 170 (164 residues), 42.3 bits, see alignment E=1.2e-14 PF13561: adh_short_C2" amino acids 12 to 247 (236 residues), 200.9 bits, see alignment E=3.6e-63

Best Hits

Swiss-Prot: 39% identical to HCDR_XANP2: 2-(R)-hydroxypropyl-CoM dehydrogenase (xecD) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: None (inferred from 61% identity to bbr:BB0371)

MetaCyc: 38% identical to cyclohexanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF1171 Dihydroanticapsin 7-dehydrogenase (Xanthobacter sp. DMC5)
MLQGKVALITGAGIGIGRCAAELFARHGGRIVVAEINEEAGRETAARIHAAGGDALFVRT
DVTDAASVEAAVAAGVAHYGRLDVIYNNAGGSTTRDSDLTRAPDDEFWRAMTLDLHGTWL
VSRFGIPELVKAGGGAVVNAASVVALMGWPGKDAYTAAKGAVAALTRSMAVEYAPHNIRV
NAVAPGVTRTPRVVAQLEQLETTQRLTAAHLLGMVEPEHVAQAALFLASEASGRTTGHVL
PVDSGLSIS