Protein Info for GFF1166 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details PF00520: Ion_trans" amino acids 27 to 249 (223 residues), 98.2 bits, see alignment E=6.6e-32 PF07885: Ion_trans_2" amino acids 166 to 241 (76 residues), 56.5 bits, see alignment E=3e-19 PF00027: cNMP_binding" amino acids 284 to 362 (79 residues), 52.1 bits, see alignment E=7.6e-18

Best Hits

KEGG orthology group: None (inferred from 76% identity to xau:Xaut_4567)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>GFF1166 hypothetical protein (Xanthobacter sp. DMC5)
MKEQPARRRVFDILERDLPGDRTADFVHYFLIGMVLLSVTGAVLATVQSLEIRDAWWFKI
GEFTALLIFTVEYGFRLWVAPEHPLRRGMSNARARLNYALTLPALIDLIAILPWFVALAT
DFDPHALLVLRLVRFLKLARYSSGFNALYLAIRRERYALLSCLIILCSGVLMSATAMYLT
ERNVQPDKFGSIPLAMWWSITTLTTVGYGDVVPVTNLGRVIGGITMISGLMMLALPIAII
AGSFAEVISKHNFVVTFSMIARLPPFSDLEAPVLGDILPVLHSRSYDRGHHVVRRGEEAA
HLFVVLEGRVEMESPDGIRSLGPGEVFGLLPGHTKPDPATVRAVAKTKILSIEENELYML
ALRHPDVIGRLSELHPDARPEGDAPAS