Protein Info for GFF1163 in Xanthobacter sp. DMC5

Annotation: Glutamine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 371 to 386 (16 residues), see Phobius details TIGR00653: glutamine synthetase, type I" amino acids 8 to 470 (463 residues), 661.7 bits, see alignment E=2.7e-203 PF03951: Gln-synt_N" amino acids 17 to 98 (82 residues), 109.6 bits, see alignment E=4.6e-36 PF00120: Gln-synt_C" amino acids 106 to 468 (363 residues), 461 bits, see alignment E=2.5e-142

Best Hits

Swiss-Prot: 91% identical to GLN1B_AZOC5: Glutamine synthetase (glnA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 97% identity to xau:Xaut_3585)

MetaCyc: 63% identical to glutamine synthetase (Escherichia coli K-12 substr. MG1655)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF1163 Glutamine synthetase (Xanthobacter sp. DMC5)
MTTKTAKDVLDLIKSEDVKYVDLRFTDPRGKWQHVTFDISMVDEEFLTEGTAFDGSSIAG
WKAINESDMLLMPDPTTTCIDPFFSETTLSIVCDVLEPTTGQPYGRDPRSIARKAEAYAK
STGVGDAVYFGPEAEFFIFDDVRFKADPYNTGFKLDSIELPTNGDTEYEGGNLGHRVKTK
GGYFPVPPIDSAQDMRSEMLAAMAKMGAKVEKHHHEVASAQHELGLKFGSLVTMADHLQV
YKYCIHQVANIYGKTATFMPKPVFGDNGSGMHVHQSIWKEGKPLFAGDKYADLSEYCLWY
IGGIIKHAKSLNAFTNPLTNSYKRLVPGYEAPVLLAYSARNRSASCRIPYTNNPKAKRVE
VRFPDPGANPYLAFAALFMAGMDGILNRIDPGQAMDKDLYDLPPAELKQIPTVCGSLREA
LASLEADHEYLLKGDVFQKDFIESYIDLKMAEVMRFEMTPHPVEFEMYYSV