Protein Info for GFF116 in Sphingobium sp. HT1-2

Annotation: Uncharacterized ABC1 family protein XCC_1720

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 473 to 493 (21 residues), see Phobius details PF03109: ABC1" amino acids 84 to 327 (244 residues), 229.5 bits, see alignment E=1.7e-72

Best Hits

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 61% identity to swi:Swit_5397)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>GFF116 Uncharacterized ABC1 family protein XCC_1720 (Sphingobium sp. HT1-2)
MVATRDRARLAEITSVATRFGLDMLLARLGLAKGDDSAAADPPDLPRRTRQAMEALGPTY
VKLGQILATRQDLLPEAWIAEFGKLHSDAPTLPFDQLRPRLEAVLGEPVETAFARFDTAP
LAAASMAQVHRATLTDGQEVVVKIRRPGIRKAMEADLRLITHLAGIVEASSREARRFQPQ
ALVQQLLDTVLEELDFTQEGRNTDRLREDLADNPAVVIPAIHWTYCAETVLVMDYIDGVP
PRDGESLRAAGIDPAAIADLGAALVLDMVLVHGRFHGDPHPGNLLCLPGDRLALLDLGLI
GHVSARRRQEFLSFILSLRSGDAHTLADTLMVWSKASAPDPGRVLDAAEQLVARHGSGPL
VLTRMVADFFPLLRKEGLVLPPDLALIFKALITMDGVLGAIQPGFDLSQALQKARGRLVM
NQVAAAHAPEKTVALLLELSRIADDAPRLLRALTRRLEADTTPATPSPPDNGAKWIAAAI
LAAGTLIAAAHHWG