Protein Info for GFF1159 in Xanthobacter sp. DMC5

Annotation: Trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF05697: Trigger_N" amino acids 1 to 152 (152 residues), 127.9 bits, see alignment E=5.8e-41 TIGR00115: trigger factor" amino acids 11 to 425 (415 residues), 427.1 bits, see alignment E=3.3e-132 PF00254: FKBP_C" amino acids 166 to 245 (80 residues), 64 bits, see alignment E=2e-21 PF05698: Trigger_C" amino acids 268 to 426 (159 residues), 142.1 bits, see alignment E=2.6e-45

Best Hits

Swiss-Prot: 85% identical to TIG_XANP2: Trigger factor (tig) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K03545, trigger factor (inferred from 85% identity to xau:Xaut_3590)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>GFF1159 Trigger factor (Xanthobacter sp. DMC5)
MQVTETGAEGLKRAFRVVVSAADLDARADARLNELKGQVKLNGFRPGKVPVAHLKRVYGK
SVMSEIIEQTVNETNGKIVEEHGFKLALQPRIKGPEEDPQFQTLLDGGKDLAYDVELEIL
PKIELGNFKDISVEKPVVEVTEAEVDEAVQRIADANRPFATKEGPAAEGDRVTIDFTGYV
DGEKFQGGEGQDIDVLIGSKGFIPGFEEQLVGASAGENRTLNVNFPEAYAAKELAGKAAT
FEVTVKSVDAPGAIAVDDAFAATLGQESVEKLRETVKARIAQEYAGAARQKVKRALLDGL
DATHKFDVPEGLVEQEFYGVWSRVNEDLAAQGRTFVDEGTTEEEARQDYRRIAERRVRLG
LVLAEIGERNNIQVSDDEVTRAVVERARQFPGQEQQVWDYYRRTPEALASVRAPLFEEKV
VDFLLELANVTEKTVTKEELFKDDEDEKAA