Protein Info for PS417_05880 in Pseudomonas simiae WCS417

Annotation: ribosomal protein S12 methylthiotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 11 to 441 (431 residues), 569.5 bits, see alignment E=5.2e-175 PF00919: UPF0004" amino acids 11 to 94 (84 residues), 72.3 bits, see alignment E=4.1e-24 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 11 to 442 (432 residues), 329.2 bits, see alignment E=3.6e-102 PF04055: Radical_SAM" amino acids 148 to 326 (179 residues), 84.1 bits, see alignment E=2e-27 PF18693: TRAM_2" amino acids 383 to 443 (61 residues), 75.6 bits, see alignment E=3.8e-25

Best Hits

Swiss-Prot: 96% identical to RIMO_PSEPF: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 99% identity to pfs:PFLU1203)

MetaCyc: 71% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYN0 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PS417_05880 ribosomal protein S12 methylthiotransferase (Pseudomonas simiae WCS417)
MSTTIAKANPKVGFVSLGCPKALVDSERILTQLRMEGYDVVSTYQDADVVVVNTCGFIDS
AKAESLEVIGEAIKENGKVIVTGCMGVEEGNIRNVHPSVLAVTGPQQYEQVVNAVHDVVP
PRQDHNPLIDLVPPQGIKLTPRHYAYLKISEGCNHSCSFCIIPSMRGKLVSRPVGDVLDE
AQRLVKSGVKELLVISQDTSAYGVDVKYRTGFWNGAPVKTRMTELCEALSSLGVWVRLHY
VYPYPHVDELIPLMAAGKILPYLDIPFQHASPKVLKAMKRPAFEDKTLARIKNWREICPE
LIIRSTFIVGFPGETEEDFQYLLDWLTEAQLDRVGCFQYSPVEGAPANLLDLAVVPDDLK
QDRWERFMAHQQAISSARLQLRIGKEIEVLIDEVDEQGAVGRCFFDAPEIDGNVFIDDAS
GLKPGDKVWCTVTDADEYDLWAEKRD