Protein Info for PS417_05855 in Pseudomonas simiae WCS417

Annotation: ferredoxin-NADP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00970: FAD_binding_6" amino acids 16 to 99 (84 residues), 29.5 bits, see alignment E=8.4e-11 PF00175: NAD_binding_1" amino acids 113 to 229 (117 residues), 32.5 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 82% identical to FENR_AZOVI: Ferredoxin--NADP reductase (fpr) from Azotobacter vinelandii

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 98% identity to pfl:PFL_1241)

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.2

Use Curated BLAST to search for 1.18.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0E7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PS417_05855 ferredoxin-NADP reductase (Pseudomonas simiae WCS417)
MSNMNHERVLSVHHWNDTLFSFKCTRDPGLRFENGQFVMIGLQQPNGRPLMRAYSIASPN
WEEHLEFFSIKVPDGPLTSQLQHLKEGDEIIISKKPTGTLVLDDLKPGKHLYLLSTGTGL
APFMSVIQDPETYERFEKVILCHGVRYVNEVAYREFITEHLPQNEFFGEALRDKLIYYPT
VTREPFENEGRLTDLMRSGKLFSDIGLPPINPEDDRAMLCGSPSMLDETSEVLNSFGLKV
SPRMREPGDYLIERAFVEK